SCOPe 2.08: Domain d1peea1: 1pee A:1-179

Lineage for d1peea1 (1pee A:1-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
   Uniprot Q26241

8. Domain d1peea1: 1pee A:1-179 [104126]
   Other proteins in same PDB: d1peea2
   complexed with hem, imd

Details for d1peea1

PDB Entry: 1pee, 1.5 Å

PDB Description: Crystal Structure of Nitrophorin 2 complex with imidazole

PDB Compounds: (A:) Nitrophorin 2

SCOPe Domain Sequences for d1peea1:

Sequence; same for both SEQRES and ATOM records:

>d1peea1 b.60.1.1 (A:1-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
dcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d1peea1:

• d1peea1 first appeared in SCOP 1.69, called d1peea_
  
• d1peea1 appears in SCOPe 2.07