SCOPe 2.05: Domain d1pd6a_: 1pd6 A:

Lineage for d1pd6a_ (1pd6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Cardiac myosin binding protein C, different domains [89185] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries)
   Uniprot Q14896 358-451, 641-770

8. Domain d1pd6a_: 1pd6 A: [104121]

Details for d1pd6a_

PDB Entry: 1pd6

PDB Description: the nmr structure of domain c2 of human cardiac myosin binding protein c

PDB Compounds: (A:) Myosin-binding protein C, cardiac-type, Domain C2

SCOPe Domain Sequences for d1pd6a_:

Sequence; same for both SEQRES and ATOM records:

>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
dekkstafqkklepayqvskghkirltveladhdaevkwlkngqeiqmsgskyifesiga
krtltisqcsladdaayqcvvggekcstelfvke

Timeline for d1pd6a_:

• d1pd6a_ first appeared in SCOP 1.69
  
• d1pd6a_ appears in SCOPe 2.04
  
• d1pd6a_ appears in SCOPe 2.06
  
• d1pd6a_ appears in the current release, SCOPe 2.08