Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Cardiac myosin binding protein C, different domains [89185] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries) Uniprot Q14896 358-451, 641-770 |
Domain d1pd6a_: 1pd6 A: [104121] |
PDB Entry: 1pd6 (more details)
SCOPe Domain Sequences for d1pd6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} dekkstafqkklepayqvskghkirltveladhdaevkwlkngqeiqmsgskyifesiga krtltisqcsladdaayqcvvggekcstelfvke
Timeline for d1pd6a_: