Lineage for d1pd6a_ (1pd6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753567Protein Cardiac myosin binding protein C, different domains [89185] (1 species)
  7. 2753568Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries)
    Uniprot Q14896 358-451, 641-770
  8. 2753571Domain d1pd6a_: 1pd6 A: [104121]

Details for d1pd6a_

PDB Entry: 1pd6 (more details)

PDB Description: the nmr structure of domain c2 of human cardiac myosin binding protein c
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type, Domain C2

SCOPe Domain Sequences for d1pd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
dekkstafqkklepayqvskghkirltveladhdaevkwlkngqeiqmsgskyifesiga
krtltisqcsladdaayqcvvggekcstelfvke

SCOPe Domain Coordinates for d1pd6a_:

Click to download the PDB-style file with coordinates for d1pd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pd6a_: