Lineage for d1pd5k_ (1pd5 K:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130381Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 2130382Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)
  7. 2130383Species Escherichia coli [TaxId:562] [52780] (9 PDB entries)
    Uniprot P00483
  8. 2130412Domain d1pd5k_: 1pd5 K: [104119]

Details for d1pd5k_

PDB Entry: 1pd5 (more details), 2.5 Å

PDB Description: crystal structure of e.coli chloramphenicol acetyltransferase type i at 2.5 angstrom resolution
PDB Compounds: (K:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d1pd5k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pd5k_ c.43.1.1 (K:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]}
kitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihil
arlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqd
vacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkv
lmplaiqvhhavcdgfhvgrmlnelqqycdew

SCOPe Domain Coordinates for d1pd5k_:

Click to download the PDB-style file with coordinates for d1pd5k_.
(The format of our PDB-style files is described here.)

Timeline for d1pd5k_: