![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.1: CAT-like [52778] (3 proteins) trimeric enzymes with the active sites being located in between subunits |
![]() | Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52780] (10 PDB entries) Uniprot P00483 |
![]() | Domain d1pd5c_: 1pd5 C: [104111] |
PDB Entry: 1pd5 (more details), 2.5 Å
SCOPe Domain Sequences for d1pd5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd5c_ c.43.1.1 (C:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm plaiqvhhavcdgfhvgrmlnelqqycdewqgg
Timeline for d1pd5c_: