Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) |
Family c.43.1.1: CAT-like [52778] (3 proteins) trimeric enzymes with the active sites being located in between subunits |
Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species) |
Species Escherichia coli [TaxId:562] [52780] (9 PDB entries) Uniprot P00483 |
Domain d1pd5b_: 1pd5 B: [104110] |
PDB Entry: 1pd5 (more details), 2.5 Å
SCOPe Domain Sequences for d1pd5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd5b_ c.43.1.1 (B:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} kkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihi larlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysq dvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdk vlmplaiqvhhavcdgfhvgrmlnelqqycdewqgg
Timeline for d1pd5b_: