Lineage for d1pc9b_ (1pc9 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544662Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (2 PDB entries)
  8. 544666Domain d1pc9b_: 1pc9 B: [104108]

Details for d1pc9b_

PDB Entry: 1pc9 (more details), 2.5 Å

PDB Description: Crystal Structure of BnSP-6, a Lys49-Phospholipase A2

SCOP Domain Sequences for d1pc9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc9b_ a.133.1.2 (B:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms}
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOP Domain Coordinates for d1pc9b_:

Click to download the PDB-style file with coordinates for d1pc9b_.
(The format of our PDB-style files is described here.)

Timeline for d1pc9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pc9a_