SCOP 1.69: Domain d1pc9b_: 1pc9 B:

Lineage for d1pc9b_ (1pc9 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (2 PDB entries)

8. Domain d1pc9b_: 1pc9 B: [104108]

Details for d1pc9b_

PDB Entry: 1pc9, 2.5 Å

PDB Description: Crystal Structure of BnSP-6, a Lys49-Phospholipase A2

SCOP Domain Sequences for d1pc9b_:

Sequence; same for both SEQRES and ATOM records:

>d1pc9b_ a.133.1.2 (B:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms}
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

Timeline for d1pc9b_:

• d1pc9b_ is new in SCOP 1.69
  
• d1pc9b_ appears in SCOP 1.71
  
• d1pc9b_ appears in the current release, SCOPe 2.08