Lineage for d1pc9a_ (1pc9 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein Snake phospholipase A2 [48624] (38 species)
  7. Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (3 PDB entries)
  8. Domain d1pc9a_: 1pc9 A: [104107]

Details for d1pc9a_

PDB Entry: 1pc9 (more details), 2.5 Å

PDB Description: Crystal Structure of BnSP-6, a Lys49-Phospholipase A2
PDB Compounds: (A:) BnSP-6

SCOPe Domain Sequences for d1pc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc9a_ a.133.1.2 (A:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]}
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d1pc9a_ are not available.

Timeline for d1pc9a_:

Domains from other chains:
(mouse over for more information)
d1pc9b_