SCOPe 2.08: Domain d1pc8b1: 1pc8 B:1-133

Lineage for d1pc8b1 (1pc8 B:1-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d1pc8b1: 1pc8 B:1-133 [104105]
   Other proteins in same PDB: d1pc8a_
   complexed with nag

Details for d1pc8b1

PDB Entry: 1pc8, 3.8 Å

PDB Description: crystal structure of a novel form of mistletoe lectin from himalayan viscum album l. at 3.8a resolution

PDB Compounds: (B:) Himalayan mistletoe ribosome-inactivating protein

SCOPe Domain Sequences for d1pc8b1:

Sequence; same for both SEQRES and ATOM records:

>d1pc8b1 b.42.2.1 (B:1-133) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
dytlgqgwlagnd

Timeline for d1pc8b1:

• d1pc8b1 first appeared in SCOP 1.69
  
• d1pc8b1 appears in SCOPe 2.07