![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Mistletoe lectin I A-chain [56381] (1 species) |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [56382] (12 PDB entries) different sequence variants Uniprot P81446 1-249 Uniprot Q6ITZ3 1-240 |
![]() | Domain d1pc8a_: 1pc8 A: [104104] Other proteins in same PDB: d1pc8b1, d1pc8b2 complexed with nag |
PDB Entry: 1pc8 (more details), 3.8 Å
SCOPe Domain Sequences for d1pc8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pc8a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]} yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
Timeline for d1pc8a_: