Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Phosphate-binding protein [53860] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [110747] (1 PDB entry) Uniprot P15712 |
Domain d1pc3a_: 1pc3 A: [104102] complexed with po4 |
PDB Entry: 1pc3 (more details), 2.16 Å
SCOPe Domain Sequences for d1pc3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} vattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtvn igasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtiktw ddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfpa vpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqsi qaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwait dgnkasfldqvhfqplppavvklsdaliatiss
Timeline for d1pc3a_: