Lineage for d1pc3a_ (1pc3 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 495075Protein Phosphate-binding protein [53860] (2 species)
  7. 495091Species Mycobacterium tuberculosis [TaxId:1773] [110747] (1 PDB entry)
  8. 495092Domain d1pc3a_: 1pc3 A: [104102]

Details for d1pc3a_

PDB Entry: 1pc3 (more details), 2.16 Å

PDB Description: Crystal structure of the extracellular phosphate ABC transport receptor (PstS-1) and immunodominant antigen of M. tuberculosis.

SCOP Domain Sequences for d1pc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium tuberculosis}
vattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtvn
igasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtiktw
ddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfpa
vpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqsi
qaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwait
dgnkasfldqvhfqplppavvklsdaliatiss

SCOP Domain Coordinates for d1pc3a_:

Click to download the PDB-style file with coordinates for d1pc3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc3a_: