Lineage for d1pa0b_ (1pa0 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649352Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (2 PDB entries)
  8. 649354Domain d1pa0b_: 1pa0 B: [104098]

Details for d1pa0b_

PDB Entry: 1pa0 (more details), 2.2 Å

PDB Description: crystal structure of bnsp-7, a lys49-phospholipase a2
PDB Compounds: (B:) Myotoxic phospholipase A2-like

SCOP Domain Sequences for d1pa0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa0b_ a.133.1.2 (B:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]}
slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOP Domain Coordinates for d1pa0b_:

Click to download the PDB-style file with coordinates for d1pa0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pa0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pa0a_