Lineage for d1pa0b_ (1pa0 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2011813Protein Snake phospholipase A2 [48624] (37 species)
  7. 2011958Species Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId:95649] [110032] (3 PDB entries)
  8. 2011960Domain d1pa0b_: 1pa0 B: [104098]

Details for d1pa0b_

PDB Entry: 1pa0 (more details), 2.2 Å

PDB Description: crystal structure of bnsp-7, a lys49-phospholipase a2
PDB Compounds: (B:) Myotoxic phospholipase A2-like

SCOPe Domain Sequences for d1pa0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pa0b_ a.133.1.2 (B:) Snake phospholipase A2 {Neuwied's lancehead (Bothrops neuwiedi pauloensis), different isoforms [TaxId: 95649]}
slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

SCOPe Domain Coordinates for d1pa0b_:

Click to download the PDB-style file with coordinates for d1pa0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pa0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pa0a_