SCOPe 2.07: Domain d1p9qc3: 1p9q C:162-234

Lineage for d1p9qc3 (1p9q C:162-234)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.3: Hypothetical protein AF0491, C-terminal domain [110976] (1 protein)

6. Protein Hypothetical protein AF0491, C-terminal domain [110977] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [110978] (2 PDB entries)
   Uniprot O29759

8. Domain d1p9qc3: 1p9q C:162-234 [104095]
   Other proteins in same PDB: d1p9qc1, d1p9qc2
   Structural genomics target

Details for d1p9qc3

PDB Entry: 1p9q, 2 Å

PDB Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus

PDB Compounds: (C:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1p9qc3:

Sequence; same for both SEQRES and ATOM records:

>d1p9qc3 d.58.11.3 (C:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
eemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkva
kgealtkvlrrig

Timeline for d1p9qc3:

• d1p9qc3 first appeared in SCOP 1.69
  
• d1p9qc3 appears in SCOPe 2.06
  
• d1p9qc3 appears in the current release, SCOPe 2.08