Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.3: Hypothetical protein AF0491, C-terminal domain [110976] (1 protein) |
Protein Hypothetical protein AF0491, C-terminal domain [110977] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [110978] (2 PDB entries) Uniprot O29759 |
Domain d1p9qc3: 1p9q C:162-234 [104095] Other proteins in same PDB: d1p9qc1, d1p9qc2 Structural genomics target |
PDB Entry: 1p9q (more details), 2 Å
SCOPe Domain Sequences for d1p9qc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9qc3 d.58.11.3 (C:162-234) Hypothetical protein AF0491, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} eemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkva kgealtkvlrrig
Timeline for d1p9qc3: