Lineage for d1p9qc2 (1p9q C:2-86)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616655Fold d.235: FYSH domain [89894] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234
  4. 616656Superfamily d.235.1: FYSH domain [89895] (2 families) (S)
  5. 616661Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein)
  6. 616662Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species)
  7. 616663Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries)
  8. 616665Domain d1p9qc2: 1p9q C:2-86 [104094]
    Other proteins in same PDB: d1p9qc1, d1p9qc3
    Structural genomics target

Details for d1p9qc2

PDB Entry: 1p9q (more details), 2 Å

PDB Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus

SCOP Domain Sequences for d1p9qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9qc2 d.235.1.2 (C:2-86) Hypothetical protein AF0491, N-terminal domain {Archaeon Archaeoglobus fulgidus}
vsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvd
elrkifgtddvfeiarkiilegevq

SCOP Domain Coordinates for d1p9qc2:

Click to download the PDB-style file with coordinates for d1p9qc2.
(The format of our PDB-style files is described here.)

Timeline for d1p9qc2: