Lineage for d1p9qc2 (1p9q C:2-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008360Fold d.235: FYSH domain [89894] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234
  4. 3008361Superfamily d.235.1: FYSH domain [89895] (3 families) (S)
  5. 3008366Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein)
    automatically mapped to Pfam PF01172
  6. 3008367Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species)
  7. 3008368Species Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries)
    Uniprot O29759
  8. 3008370Domain d1p9qc2: 1p9q C:2-86 [104094]
    Other proteins in same PDB: d1p9qc1, d1p9qc3
    Structural genomics target

Details for d1p9qc2

PDB Entry: 1p9q (more details), 2 Å

PDB Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus
PDB Compounds: (C:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1p9qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9qc2 d.235.1.2 (C:2-86) Hypothetical protein AF0491, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
vsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvd
elrkifgtddvfeiarkiilegevq

SCOPe Domain Coordinates for d1p9qc2:

Click to download the PDB-style file with coordinates for d1p9qc2.
(The format of our PDB-style files is described here.)

Timeline for d1p9qc2: