Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.235: FYSH domain [89894] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234 |
Superfamily d.235.1: FYSH domain [89895] (3 families) |
Family d.235.1.2: Hypothetical protein AF0491, N-terminal domain [110893] (1 protein) automatically mapped to Pfam PF01172 |
Protein Hypothetical protein AF0491, N-terminal domain [110894] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [110895] (2 PDB entries) Uniprot O29759 |
Domain d1p9qc2: 1p9q C:2-86 [104094] Other proteins in same PDB: d1p9qc1, d1p9qc3 Structural genomics target |
PDB Entry: 1p9q (more details), 2 Å
SCOPe Domain Sequences for d1p9qc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p9qc2 d.235.1.2 (C:2-86) Hypothetical protein AF0491, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} vsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvd elrkifgtddvfeiarkiilegevq
Timeline for d1p9qc2: