Lineage for d1p9qc1 (1p9q C:87-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696323Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (2 families) (S)
  5. 2696324Family a.5.8.1: Hypothetical protein AF0491, middle domain [109729] (1 protein)
  6. 2696325Protein Hypothetical protein AF0491, middle domain [109730] (1 species)
  7. 2696326Species Archaeoglobus fulgidus [TaxId:2234] [109731] (2 PDB entries)
    Uniprot O29759
  8. 2696328Domain d1p9qc1: 1p9q C:87-161 [104093]
    Other proteins in same PDB: d1p9qc2, d1p9qc3
    Structural genomics target

Details for d1p9qc1

PDB Entry: 1p9q (more details), 2 Å

PDB Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus
PDB Compounds: (C:) Hypothetical protein AF0491

SCOPe Domain Sequences for d1p9qc1:

Sequence, based on SEQRES records: (download)

>d1p9qc1 a.5.8.1 (C:87-161) Hypothetical protein AF0491, middle domain {Archaeoglobus fulgidus [TaxId: 2234]}
itaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifksveaqv
kdivkalkpilplkf

Sequence, based on observed residues (ATOM records): (download)

>d1p9qc1 a.5.8.1 (C:87-161) Hypothetical protein AF0491, middle domain {Archaeoglobus fulgidus [TaxId: 2234]}
itaeqrremleakrkqiinfisrntidpaphppsrieraleeakvhidifksveaqvkdi
vkalkpilplkf

SCOPe Domain Coordinates for d1p9qc1:

Click to download the PDB-style file with coordinates for d1p9qc1.
(The format of our PDB-style files is described here.)

Timeline for d1p9qc1: