Lineage for d1p9eb_ (1p9e B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613304Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 613305Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (6 families) (S)
  5. 613389Family d.157.1.5: Methyl parathion hydrolase [111227] (1 protein)
  6. 613390Protein Methyl parathion hydrolase [111228] (1 species)
  7. 613391Species pseudomonas sp wbc-3 [111229] (1 PDB entry)
  8. 613393Domain d1p9eb_: 1p9e B: [104089]
    complexed with cd, k, na, zn

Details for d1p9eb_

PDB Entry: 1p9e (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Methyl Parathion Hydrolase from Pseudomonas sp WBC-3

SCOP Domain Sequences for d1p9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9eb_ d.157.1.5 (B:) Methyl parathion hydrolase {pseudomonas sp wbc-3}
aapqvrtsapgyyrmllgdfeitalsdgtvalpvdkrlnqpapktqsalaksfqkaplet
svtgylvntgsklvlvdtgaaglfgptlgrlaanlkaagyqpeqvdeiyithmhpdhvgg
lmvgeqlafpnavvradqkeadfwlsqtnldkapddeskgffkgamaslnpyvkagkfkp
fsgntdlvpgikalashghtpghttyvvesqgqklallgdlilvaavqfddpsvttqlds
dsksvaverkkafadaakggyliaashlsfpgighiraegkgyrfvpvnysvvn

SCOP Domain Coordinates for d1p9eb_:

Click to download the PDB-style file with coordinates for d1p9eb_.
(The format of our PDB-style files is described here.)

Timeline for d1p9eb_: