Lineage for d1p9ea_ (1p9e A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513372Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 513373Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families) (S)
  5. 513450Family d.157.1.5: Methyl parathion hydrolase [111227] (1 protein)
  6. 513451Protein Methyl parathion hydrolase [111228] (1 species)
  7. 513452Species pseudomonas sp wbc-3 [111229] (1 PDB entry)
  8. 513453Domain d1p9ea_: 1p9e A: [104088]

Details for d1p9ea_

PDB Entry: 1p9e (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Methyl Parathion Hydrolase from Pseudomonas sp WBC-3

SCOP Domain Sequences for d1p9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {pseudomonas sp wbc-3}
aapqvrtsapgyyrmllgdfeitalsdgtvalpvdkrlnqpapktqsalaksfqkaplet
svtgylvntgsklvlvdtgaaglfgptlgrlaanlkaagyqpeqvdeiyithmhpdhvgg
lmvgeqlafpnavvradqkeadfwlsqtnldkapddeskgffkgamaslnpyvkagkfkp
fsgntdlvpgikalashghtpghttyvvesqgqklallgdlilvaavqfddpsvttqlds
dsksvaverkkafadaakggyliaashlsfpgighiraegkgyrfvpvnysvvn

SCOP Domain Coordinates for d1p9ea_:

Click to download the PDB-style file with coordinates for d1p9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1p9ea_: