Lineage for d1p92a2 (1p92 A:65-139)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331932Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2331933Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2331934Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2331935Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2331936Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2331943Domain d1p92a2: 1p92 A:65-139 [104086]
    Other proteins in same PDB: d1p92a1, d1p92a3
    complexed with bme

Details for d1p92a2

PDB Entry: 1p92 (more details), 2.1 Å

PDB Description: crystal structure of (h79a)dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1p92a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p92a2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkarlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

SCOPe Domain Coordinates for d1p92a2:

Click to download the PDB-style file with coordinates for d1p92a2.
(The format of our PDB-style files is described here.)

Timeline for d1p92a2: