Lineage for d1p8aa_ (1p8a A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482762Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2482763Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2482764Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2482788Protein Tyrosine phosphatase [52790] (5 species)
  7. 2482829Species Tritrichomonas foetus [TaxId:5724] [110595] (1 PDB entry)
    Uniprot O00810
  8. 2482830Domain d1p8aa_: 1p8a A: [104084]

Details for d1p8aa_

PDB Entry: 1p8a (more details)

PDB Description: solution structure of the low molecular weight protein tyrosine phosphatase from tritrichomonas foetus
PDB Compounds: (A:) protein tyrosine phosphatase

SCOPe Domain Sequences for d1p8aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8aa_ c.44.1.1 (A:) Tyrosine phosphatase {Tritrichomonas foetus [TaxId: 5724]}
aaekkavlfvclgnicrspacegicrdmvgdkliidsaatsgfhvgqspdtrsqkvcksn
gvdiskqrarqitkadfskfdviaaldqsilsdinsmkpsncrakvvlfnppngvddpyy
ssdgfptmfasiskemkpfltehgli

SCOPe Domain Coordinates for d1p8aa_:

Click to download the PDB-style file with coordinates for d1p8aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p8aa_: