Lineage for d1p7va_ (1p7v A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 485773Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 485774Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 485775Family c.41.1.1: Subtilases [52744] (11 proteins)
  6. 485803Protein Proteinase K [52762] (1 species)
  7. 485804Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (15 PDB entries)
  8. 485807Domain d1p7va_: 1p7v A: [104082]

Details for d1p7va_

PDB Entry: 1p7v (more details), 1.08 Å

PDB Description: Structure of a complex formed between Proteinase K and a designed heptapeptide inhibitor Pro-Ala-Pro-Phe-Ala-Ala-Ala at atomic resolution

SCOP Domain Sequences for d1p7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7va_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOP Domain Coordinates for d1p7va_:

Click to download the PDB-style file with coordinates for d1p7va_.
(The format of our PDB-style files is described here.)

Timeline for d1p7va_: