Lineage for d1p7od_ (1p7o D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015926Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries)
    Uniprot Q8JFB2 # 65% sequence identity
  8. 2015930Domain d1p7od_: 1p7o D: [104079]

Details for d1p7od_

PDB Entry: 1p7o (more details), 2.3 Å

PDB Description: Crystal structure of phospholipase A2 (MIPLA4) from Micropechis ikaheka
PDB Compounds: (D:) phospholipase a2

SCOPe Domain Sequences for d1p7od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7od_ a.133.1.2 (D:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]}
nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
qlck

SCOPe Domain Coordinates for d1p7od_:

Click to download the PDB-style file with coordinates for d1p7od_.
(The format of our PDB-style files is described here.)

Timeline for d1p7od_: