Lineage for d1p7oa_ (1p7o A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750360Protein Snake phospholipase A2 [48624] (36 species)
  7. 1750539Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries)
    Uniprot Q8JFB2 # 65% sequence identity
  8. 1750540Domain d1p7oa_: 1p7o A: [104076]

Details for d1p7oa_

PDB Entry: 1p7o (more details), 2.3 Å

PDB Description: Crystal structure of phospholipase A2 (MIPLA4) from Micropechis ikaheka
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1p7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]}
nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
qlck

SCOPe Domain Coordinates for d1p7oa_:

Click to download the PDB-style file with coordinates for d1p7oa_.
(The format of our PDB-style files is described here.)

Timeline for d1p7oa_: