| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (35 species) |
| Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries) |
| Domain d1p7oa_: 1p7o A: [104076] |
PDB Entry: 1p7o (more details), 2.3 Å
SCOP Domain Sequences for d1p7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms}
nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
qlck
Timeline for d1p7oa_: