Lineage for d1p6sa_ (1p6s A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467443Protein Rac-beta serine/threonine protein kinase (PKB/AKT) [110254] (1 species)
  7. 467444Species Human (Homo sapiens) [TaxId:9606] [110255] (1 PDB entry)
  8. 467445Domain d1p6sa_: 1p6s A: [104075]

Details for d1p6sa_

PDB Entry: 1p6s (more details)

PDB Description: solution structure of the pleckstrin homology domain of human protein kinase b beta (pkb/akt)

SCOP Domain Sequences for d1p6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6sa_ b.55.1.1 (A:) Rac-beta serine/threonine protein kinase (PKB/AKT) {Human (Homo sapiens)}
mnevsvikegwlhkrgeyiktwrpryfllksdgsfigykerpeapdqtlpplnnfsvaec
qlmkterprpntfvirclqwttviertfhvdspdereewmraiqmvanslk

SCOP Domain Coordinates for d1p6sa_:

Click to download the PDB-style file with coordinates for d1p6sa_.
(The format of our PDB-style files is described here.)

Timeline for d1p6sa_: