Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (5 families) |
Family c.23.1.1: CheY-related [52173] (18 proteins) |
Protein CheY protein [52174] (4 species) |
Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries) |
Domain d1p6qa_: 1p6q A: [104074] |
PDB Entry: 1p6q (more details)
SCOP Domain Sequences for d1p6qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2} mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa ieavfgalk
Timeline for d1p6qa_: