Lineage for d1p6qa_ (1p6q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855436Protein CheY protein [52174] (6 species)
  7. 2855533Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries)
    Uniprot Q52884
  8. 2855534Domain d1p6qa_: 1p6q A: [104074]

Details for d1p6qa_

PDB Entry: 1p6q (more details)

PDB Description: nmr structure of the response regulator chey2 from sinorhizobium meliloti, complexed with mg++
PDB Compounds: (A:) CheY2

SCOPe Domain Sequences for d1p6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}
mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
ieavfgalk

SCOPe Domain Coordinates for d1p6qa_:

Click to download the PDB-style file with coordinates for d1p6qa_.
(The format of our PDB-style files is described here.)

Timeline for d1p6qa_: