Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein FKBP52, N-terminal domains [82619] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82620] (10 PDB entries) Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains |
Domain d1p5qc2: 1p5q C:145-257 [104073] Other proteins in same PDB: d1p5qa1, d1p5qb1, d1p5qc1 second FKPB domain complexed with so4 |
PDB Entry: 1p5q (more details), 2.8 Å
SCOPe Domain Sequences for d1p5qc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5qc2 d.26.1.1 (C:145-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake
Timeline for d1p5qc2:
View in 3D Domains from other chains: (mouse over for more information) d1p5qa1, d1p5qa2, d1p5qb1, d1p5qb2 |