Lineage for d1p5qb2 (1p5q B:145-257)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857598Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 857599Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
    Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
  8. 857605Domain d1p5qb2: 1p5q B:145-257 [104071]
    Other proteins in same PDB: d1p5qa1, d1p5qb1, d1p5qc1
    second FKPB domain

Details for d1p5qb2

PDB Entry: 1p5q (more details), 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain
PDB Compounds: (B:) FK506-binding protein 4

SCOP Domain Sequences for d1p5qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5qb2 d.26.1.1 (B:145-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

SCOP Domain Coordinates for d1p5qb2:

Click to download the PDB-style file with coordinates for d1p5qb2.
(The format of our PDB-style files is described here.)

Timeline for d1p5qb2: