SCOP 1.71: Domain d1p5qb1: 1p5q B:258-427

Lineage for d1p5qb1 (1p5q B:258-427)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (2 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)

8. Domain d1p5qb1: 1p5q B:258-427 [104070]
   Other proteins in same PDB: d1p5qa2, d1p5qb2, d1p5qc2

Details for d1p5qb1

PDB Entry: 1p5q, 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain

SCOP Domain Sequences for d1p5qb1:

Sequence; same for both SEQRES and ATOM records:

>d1p5qb1 a.118.8.1 (B:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens)}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka

Timeline for d1p5qb1:

• d1p5qb1 first appeared in SCOP 1.69
  
• d1p5qb1 appears in SCOP 1.73
  
• d1p5qb1 appears in the current release, SCOPe 2.08