SCOPe 2.02: Domain d1p5qa2: 1p5q A:145-257

Lineage for d1p5qa2 (1p5q A:145-257)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP52, N-terminal domains [82619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
   Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains

8. Domain d1p5qa2: 1p5q A:145-257 [104069]
   Other proteins in same PDB: d1p5qa1, d1p5qb1, d1p5qc1
   second FKPB domain
   complexed with so4

Details for d1p5qa2

PDB Entry: 1p5q, 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain

PDB Compounds: (A:) FK506-binding protein 4

SCOPe Domain Sequences for d1p5qa2:

Sequence; same for both SEQRES and ATOM records:

>d1p5qa2 d.26.1.1 (A:145-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

Timeline for d1p5qa2:

• d1p5qa2 first appeared in SCOP 1.69
  
• d1p5qa2 appears in SCOPe 2.01
  
• d1p5qa2 appears in SCOPe 2.03
  
• d1p5qa2 appears in the current release, SCOPe 2.08