Lineage for d1p5qa1 (1p5q A:258-427)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096255Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)
  7. 1096256Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
    Uniprot Q02790 145-427
  8. 1096257Domain d1p5qa1: 1p5q A:258-427 [104068]
    Other proteins in same PDB: d1p5qa2, d1p5qb2, d1p5qc2
    second FKPB domain
    complexed with so4

Details for d1p5qa1

PDB Entry: 1p5q (more details), 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain
PDB Compounds: (A:) FK506-binding protein 4

SCOPe Domain Sequences for d1p5qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka

SCOPe Domain Coordinates for d1p5qa1:

Click to download the PDB-style file with coordinates for d1p5qa1.
(The format of our PDB-style files is described here.)

Timeline for d1p5qa1: