Lineage for d1p5qa1 (1p5q A:258-427)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543061Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 543062Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 543072Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)
  7. 543073Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
  8. 543074Domain d1p5qa1: 1p5q A:258-427 [104068]
    Other proteins in same PDB: d1p5qa2, d1p5qb2, d1p5qc2

Details for d1p5qa1

PDB Entry: 1p5q (more details), 2.8 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain

SCOP Domain Sequences for d1p5qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens)}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglsrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenkaka

SCOP Domain Coordinates for d1p5qa1:

Click to download the PDB-style file with coordinates for d1p5qa1.
(The format of our PDB-style files is described here.)

Timeline for d1p5qa1: