Lineage for d1p5ja_ (1p5j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139860Protein L-serine dehydratase [102668] (2 species)
  7. 2139861Species Human (Homo sapiens) [TaxId:9606] [110721] (1 PDB entry)
    Uniprot P20132
  8. 2139862Domain d1p5ja_: 1p5j A: [104067]
    complexed with plp

Details for d1p5ja_

PDB Entry: 1p5j (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of Human Serine Dehydratase
PDB Compounds: (A:) L-serine dehydratase

SCOPe Domain Sequences for d1p5ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]}
geplhvktpirdsmalskmagtsvylkmdsaqpsgsfkirgighfckrwakqgcahfvcs
sagnagmaaayaarqlgvpativvpgttpaltierlknegatckvvgelldeafelakal
aknnpgwvyippfddpliweghasivkelketlwekpgaialsvggggllcgvvqglqec
gwgdvpviametfgahsfhaattagklvslpkitsvakalgvktvgsqalklfqehpifs
evisdqeavaaiekfvddekilvepacgaalaavyshviqklqlegnlrtplpslvvivc
ggsnislaqlralkeqlgm

SCOPe Domain Coordinates for d1p5ja_:

Click to download the PDB-style file with coordinates for d1p5ja_.
(The format of our PDB-style files is described here.)

Timeline for d1p5ja_: