Lineage for d1p2xa_ (1p2x A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443178Fold a.40: CH domain-like [47575] (2 superfamilies)
    core: 4 helices: bundle
  4. 443179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 443180Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 443225Protein Ras GTPase-activating-like protein rng2 [101196] (1 species)
  7. 443226Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101197] (2 PDB entries)
  8. 443227Domain d1p2xa_: 1p2x A: [104062]

Details for d1p2xa_

PDB Entry: 1p2x (more details), 2.21 Å

PDB Description: crystal structure of the calponin-homology domain of rng2 from schizosaccharomyces pombe

SCOP Domain Sequences for d1p2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe)}
retlqaydylcrvdeakkwieeclgtdlgptstfeqslrngvvlallvqkfqpdklikif
ysnelqfrhsdninkfldfihgiglpeifhfeltdiyegknlpkviycihalsyflsmqd
lappliksdenlsftdedvsiivrrlrqsnvilpnfkal

SCOP Domain Coordinates for d1p2xa_:

Click to download the PDB-style file with coordinates for d1p2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1p2xa_: