Lineage for d1p2xa_ (1p2x A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712073Protein Ras GTPase-activating-like protein rng2 [101196] (1 species)
  7. 2712074Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [101197] (2 PDB entries)
    Uniprot O14188 32-190
  8. 2712076Domain d1p2xa_: 1p2x A: [104062]
    complexed with br

Details for d1p2xa_

PDB Entry: 1p2x (more details), 2.21 Å

PDB Description: crystal structure of the calponin-homology domain of rng2 from schizosaccharomyces pombe
PDB Compounds: (A:) Ras GTPase-activating-like protein

SCOPe Domain Sequences for d1p2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2xa_ a.40.1.1 (A:) Ras GTPase-activating-like protein rng2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
retlqaydylcrvdeakkwieeclgtdlgptstfeqslrngvvlallvqkfqpdklikif
ysnelqfrhsdninkfldfihgiglpeifhfeltdiyegknlpkviycihalsyflsmqd
lappliksdenlsftdedvsiivrrlrqsnvilpnfkal

SCOPe Domain Coordinates for d1p2xa_:

Click to download the PDB-style file with coordinates for d1p2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1p2xa_: