Lineage for d1p1xb_ (1p1x B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475346Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 475397Protein Deoxyribose-phosphate aldolase DeoC [69394] (5 species)
  7. 475404Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
  8. 475406Domain d1p1xb_: 1p1x B: [104061]

Details for d1p1xb_

PDB Entry: 1p1x (more details), 0.99 Å

PDB Description: comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution

SCOP Domain Sequences for d1p1xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1xb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli}
hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
esarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgass
llasllkalgh

SCOP Domain Coordinates for d1p1xb_:

Click to download the PDB-style file with coordinates for d1p1xb_.
(The format of our PDB-style files is described here.)

Timeline for d1p1xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p1xa_