Lineage for d1p1xb1 (1p1x B:1001-1250)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834502Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2834509Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
    Uniprot P00882
  8. 2834515Domain d1p1xb1: 1p1x B:1001-1250 [104061]
    Other proteins in same PDB: d1p1xb2

Details for d1p1xb1

PDB Entry: 1p1x (more details), 0.99 Å

PDB Description: comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1p1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1xb1 c.1.10.1 (B:1001-1250) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

SCOPe Domain Coordinates for d1p1xb1:

Click to download the PDB-style file with coordinates for d1p1xb1.
(The format of our PDB-style files is described here.)

Timeline for d1p1xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p1xb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p1xa_