SCOPe 2.07: Domain d1p1xa_: 1p1x A:

Lineage for d1p1xa_ (1p1x A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)

7. Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
   Uniprot P00882

8. Domain d1p1xa_: 1p1x A: [104060]
   Other proteins in same PDB: d1p1xb2

Details for d1p1xa_

PDB Entry: 1p1x, 0.99 Å

PDB Description: comparison of class i aldolase binding site architecture based on the crystal structure of 2-deoxyribose-5-phosphate aldolase determined at 0.99 angstrom resolution

PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1p1xa_:

Sequence; same for both SEQRES and ATOM records:

>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

Timeline for d1p1xa_:

• d1p1xa_ first appeared in SCOP 1.69
  
• d1p1xa_ appears in SCOPe 2.06
  
• d1p1xa_ appears in the current release, SCOPe 2.08