![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [69395] (4 PDB entries) Uniprot P00882 |
![]() | Domain d1p1xa_: 1p1x A: [104060] Other proteins in same PDB: d1p1xb2 |
PDB Entry: 1p1x (more details), 0.99 Å
SCOPe Domain Sequences for d1p1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl lasllkalgh
Timeline for d1p1xa_: