Lineage for d1p1aa_ (1p1a A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499577Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)
  7. 499578Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
  8. 499580Domain d1p1aa_: 1p1a A: [104059]

Details for d1p1aa_

PDB Entry: 1p1a (more details)

PDB Description: NMR structure of ubiquitin-like domain of hHR23B

SCOP Domain Sequences for d1p1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1aa_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens)}
gshmqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddt
alkeykideknfvvvmvtkpkavst

SCOP Domain Coordinates for d1p1aa_:

Click to download the PDB-style file with coordinates for d1p1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p1aa_: