Lineage for d1p1aa1 (1p1a A:4-85)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
    Uniprot P54727 1-82
  8. Domain d1p1aa1: 1p1a A:4-85 [104059]
    Other proteins in same PDB: d1p1aa2

Details for d1p1aa1

PDB Entry: 1p1a (more details)

PDB Description: NMR structure of ubiquitin-like domain of hHR23B
PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1p1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1aa1 d.15.1.1 (A:4-85) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavst

SCOPe Domain Coordinates for d1p1aa1 are not available.

Timeline for d1p1aa1:

Domains from same chain:
(mouse over for more information)
d1p1aa2