SCOPe 2.08: Domain d1p1aa1: 1p1a A:4-85

Lineage for d1p1aa1 (1p1a A:4-85)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
   Uniprot P54727 1-82

8. Domain d1p1aa1: 1p1a A:4-85 [104059]
   Other proteins in same PDB: d1p1aa2

Details for d1p1aa1

PDB Entry: 1p1a

PDB Description: nmr structure of ubiquitin-like domain of hhr23b

PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1p1aa1:

Sequence; same for both SEQRES and ATOM records:

>d1p1aa1 d.15.1.1 (A:4-85) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavst

Timeline for d1p1aa1:

• d1p1aa1 first appeared in SCOP 1.69, called d1p1aa_
  
• d1p1aa1 appears in SCOPe 2.07