Lineage for d1p19b_ (1p19 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128315Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2128326Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
    Uniprot Q27796
  8. 2128342Domain d1p19b_: 1p19 B: [104056]
    complexed with imp

Details for d1p19b_

PDB Entry: 1p19 (more details), 2.3 Å

PDB Description: Hypoxanthine Phosphoribosyltransferase from Trypanosoma cruzi, in complex with the product IMP
PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1p19b_:

Sequence, based on SEQRES records: (download)

>d1p19b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
reyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlc
ralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlny
lyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdi
vvlrpevyaereaarq

Sequence, based on observed residues (ATOM records): (download)

>d1p19b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
reyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlc
ralcdfnvpvrmeficvsrmlldtrhsieghhvlivedivdtaltlnylyhmyftrrpas
lktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrpevyaere
aarq

SCOPe Domain Coordinates for d1p19b_:

Click to download the PDB-style file with coordinates for d1p19b_.
(The format of our PDB-style files is described here.)

Timeline for d1p19b_: