Lineage for d1p17d_ (1p17 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489867Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 489868Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 489869Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)
  6. 489918Protein Hypoxanthine PRTase [53286] (3 species)
  7. 489929Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
  8. 489951Domain d1p17d_: 1p17 D: [104052]

Details for d1p17d_

PDB Entry: 1p17 (more details), 2.7 Å

PDB Description: Hypoxanthine Phosphoribosyltransferase from Trypanosoma cruzi, K68R mutant, complexed with the product IMP

SCOP Domain Sequences for d1p17d_:

Sequence, based on SEQRES records: (download)

>d1p17d_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma cruzi}
preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
cralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltln
ylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrd
ivvlrpevyaereaarq

Sequence, based on observed residues (ATOM records): (download)

>d1p17d_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma cruzi}
preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl
cralcdfnvpvrmeficvssyvrmlldtrhsieghhvlivedivdtaltlnylyhmyftr
rpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrpevy
aereaarq

SCOP Domain Coordinates for d1p17d_:

Click to download the PDB-style file with coordinates for d1p17d_.
(The format of our PDB-style files is described here.)

Timeline for d1p17d_: