![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine PRTase [53286] (4 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries) Uniprot Q27796 |
![]() | Domain d1p17d_: 1p17 D: [104052] complexed with imp; mutant |
PDB Entry: 1p17 (more details), 2.7 Å
SCOPe Domain Sequences for d1p17d_:
Sequence, based on SEQRES records: (download)
>d1p17d_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl cralcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltln ylyhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrd ivvlrpevyaereaarq
>d1p17d_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} preyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlrgsfmftadl cralcdfnvpvrmeficvssyvrmlldtrhsieghhvlivedivdtaltlnylyhmyftr rpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivvlrpevy aereaarq
Timeline for d1p17d_: