SCOPe 2.06: Domain d1ozya_: 1ozy A:

Lineage for d1ozya_ (1ozy A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries)
   Uniprot Q8JFB2 # 65% sequence identity

8. Domain d1ozya_: 1ozy A: [104047]
   complexed with so4

Details for d1ozya_

PDB Entry: 1ozy, 2.7 Å

PDB Description: Crystal Structure of Phospholipase A2 (MIPLA3) From Micropechis Ikaheka

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1ozya_:

Sequence; same for both SEQRES and ATOM records:

>d1ozya_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]}
nllqfrkmikctipgiepllafsnygcycgkggsgtpvdeldrccqthdycydkakihpe
crgilsgpsfntyaydctdgkltcndqkdkcklficncdrtaamcfakapykeennrida
s

Timeline for d1ozya_:

• d1ozya_ first appeared in SCOP 1.69
  
• d1ozya_ appears in SCOPe 2.05
  
• d1ozya_ appears in SCOPe 2.07
  
• d1ozya_ appears in the current release, SCOPe 2.08